PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.388490.1
Common NameCsa_7G375780, LOC101204317
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 157aa    MW: 18363.6 Da    PI: 9.0648
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.388490.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eEd++l++ +++ G  +W++ +++ g+ R++k+c++rw +yl
   Cucsa.388490.1 14 RGPWSFEEDQILIKFIQLNGHSNWRALPKKAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding50.93.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+eE++ ++ +++++G++ W++Ia++++ gRt++++k+ w+++l
   Cucsa.388490.1  67 RGDFTQEEEQTIITLHQLMGNR-WAAIAARLP-GRTDNEIKNVWHTHL 112
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.116961IPR017930Myb domain
SuperFamilySSF466891.5E-2911108IPR009057Homeodomain-like
SMARTSM007174.2E-131363IPR001005SANT/Myb domain
PfamPF002491.5E-141461IPR001005SANT/Myb domain
CDDcd001671.87E-91661No hitNo description
PROSITE profilePS5129424.75962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2765116IPR009057Homeodomain-like
SMARTSM007171.2E-1466114IPR001005SANT/Myb domain
PfamPF002492.2E-1567112IPR001005SANT/Myb domain
CDDcd001676.84E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGPWSFE EDQILIKFIQ LNGHSNWRAL PKKAGLLRCG KSCRLRWTNY  60
LRPDIKRGDF TQEEEQTIIT LHQLMGNRWA AIAARLPGRT DNEIKNVWHT HLKKRVNQNE  120
ILKDQTKQNK NDDNHFHDQL SCSSEIKLDG EEDIDRX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121175109B-MYB
1gv2_A8e-28121162105MYB PROTO-ONCOGENE PROTEIN
1msf_C9e-28121162105C-Myb DNA-Binding Domain
1mse_C9e-28121162105C-Myb DNA-Binding Domain
1h89_C3e-27121184159MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-27121184159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818037e-64LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026.
GenBankLN7132557e-64LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148973.11e-112PREDICTED: myb-related protein Myb4
SwissprotQ7XBH47e-70MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0A0KAA11e-112A0A0A0KAA1_CUCSA; Uncharacterized protein
STRINGBra018267.1-P8e-72(Brassica rapa)
STRINGSolyc09g090130.2.18e-72(Solanum lycopersicum)
STRINGGSMUA_Achr1P09180_0013e-72(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.14e-74myb domain protein 15
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]